PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim08g076400.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family G2-like
Protein Properties Length: 264aa    MW: 29612.3 Da    PI: 9.4662
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim08g076400.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.45.6e-32169222255
             G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         pr+rWt++LH++Fv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Sopim08g076400.0.1 169 PRMRWTSTLHAHFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 222
                         9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.23E-15166222IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.0E-28166222IPR009057Homeodomain-like
TIGRFAMsTIGR015571.9E-23169222IPR006447Myb domain, plants
PfamPF002491.9E-6170221IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 264 aa     Download sequence    Send to blast
MELFPAQPDL SLKISPPNIK PSSSTWKRKI TSEDDIHMDL GFCKRAHVVE STNPINTSSS  60
SCFDLSLSNN PTKPNPNSSH HLHNLQNYNI SQQNQTIIRG IPVYHQKPFN TTTTTTFPIT  120
CSPCSIINNN NIKNTISSCA STRPNFQQGG FFRSRFLSRY STKRSTRAPR MRWTSTLHAH  180
FVHAVELLGG HERATPKSVL ELMDVKDLTL AHVKSHLQMY RTVKTTDRSA SSGQSEVFDN  240
LSSGDTSEEL MVDEYFDPKS KLI*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0092920.0AP009292.1 Solanum lycopersicum genomic DNA, chromosome 8, clone: C08HBa0320P23, complete sequence.
GenBankHG9755200.0HG975520.1 Solanum lycopersicum chromosome ch08, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004245982.10.0PREDICTED: probable transcription factor KAN2
SwissprotQ9C6162e-65KAN2_ARATH; Probable transcription factor KAN2
TrEMBLK4CN030.0K4CN03_SOLLC; Uncharacterized protein
STRINGSolyc08g076400.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27382255
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.16e-49G2-like family protein